Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Otoraplin (rHuOTOR)

OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3) -like domain. OTOR is predominantly expressed in the cochlea of the inner-ear and to a lesser extent in fetal brain and in some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function.

Product Specifications

Source

Escherichia coli

Endotoxin

Less than 1EU/g of rHuOTOR as determined by LAL method.

Purity

Sterile Filtered White lyophilized (freeze-dried) powder.Data Not Available.

Bioactivity

Data Not Available.

Form

Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

Molecular Weight

12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

AA Sequence

MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMG VVGYFPRNLV KEQRVYQEAT KEVPTTDIDF FCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pantothenic Acid-13C3,15N Hemicalcium Salt
TRC-P190302-1MG 1 mg

Pantothenic Acid-13C3,15N Hemicalcium Salt

Sign In for Pricing
View Details
Heptadecanedioic Acid
TRC-H998558-50MG 50 mg

Heptadecanedioic Acid

Sign In for Pricing
View Details
KLHL36 Polyclonal Antibody
E-AB-17745-01 20 µL

KLHL36 Polyclonal Antibody

Sign In for Pricing
View Details
KLHL36 Polyclonal Antibody
E-AB-17745-02 60 µL

KLHL36 Polyclonal Antibody

Sign In for Pricing
View Details
KLHL36 Polyclonal Antibody
E-AB-17745-03 120 µL

KLHL36 Polyclonal Antibody

Sign In for Pricing
View Details
KLHL36 Polyclonal Antibody
E-AB-17745-04 200 µL

KLHL36 Polyclonal Antibody

Sign In for Pricing
View Details