Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD267 Recombinant Protein

CD267 Recombinant Protein

Product Specifications

UniProt

O14836

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~22kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 8 p18 Rabbit Polyclonal Antibody
orb665900-01 30 µL

Caspase 8 p18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caspase 8 p18 Rabbit Polyclonal Antibody
orb665900-02 50 μL

Caspase 8 p18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caspase 8 p18 Rabbit Polyclonal Antibody
orb665900-03 100 µL

Caspase 8 p18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caspase 8 p18 Rabbit Polyclonal Antibody
orb665900-04 200 µL

Caspase 8 p18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPIN3 Recombinant Protein (Human)
RP029917 100 µg

SPIN3 Recombinant Protein (Human)

Sign In for Pricing
View Details
TP53BP1 Antibody
MBS8516905-01 0.1 mg

TP53BP1 Antibody

Sign In for Pricing
View Details