Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD242 Recombinant Protein

CD242 Recombinant Protein

Product Specifications

UniProt

Q14773

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~28kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rdx Antibody
orb807186 2 mg

Rdx Antibody

Sign In for Pricing
View Details
ZNF563 Antibody - N-terminal region
ARP50790_P050-25UL 25 µL

ZNF563 Antibody - N-terminal region

Sign In for Pricing
View Details
SYCE2 Antibody
E51A11977 100 µL

SYCE2 Antibody

Sign In for Pricing
View Details
PSCDBP antibody
orb73614 100 µL

PSCDBP antibody

Sign In for Pricing
View Details
Human Immunodeficiency Virus Type 1, p24 (HIV-1 p24) (HRP)
MBS6128738-01 0.1 mL

Human Immunodeficiency Virus Type 1, p24 (HIV-1 p24) (HRP)

Sign In for Pricing
View Details
Human Immunodeficiency Virus Type 1, p24 (HIV-1 p24) (HRP)
MBS6128738-02 5x 0.1 mL

Human Immunodeficiency Virus Type 1, p24 (HIV-1 p24) (HRP)

Sign In for Pricing
View Details