Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD242 Recombinant Protein

CD242 Recombinant Protein

Product Specifications

UniProt

Q14773

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~28kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK5 (E4C4B) Rabbit Monoclonal Antibody
CST 40737S 100 µL

MEK5 (E4C4B) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Micro Glucogen Content Assay Kit
OM625908 100 Tests

Micro Glucogen Content Assay Kit

Sign In for Pricing
View Details
NUP98 sgRNA CRISPR Lentivector (Human) (Target 3)
K1468704 1.0 µg DNA

NUP98 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
APC/iFluor® 750 Anti-human CD229 Antibody *HLy9.25*
122901G2-AAT 500 Tests

APC/iFluor® 750 Anti-human CD229 Antibody *HLy9.25*

Sign In for Pricing
View Details
Claudin 18 (CLDN18) Antibody
abx171763-01 200 µg

Claudin 18 (CLDN18) Antibody

Sign In for Pricing
View Details
Claudin 18 (CLDN18) Antibody
abx171763-02 1 mg

Claudin 18 (CLDN18) Antibody

Sign In for Pricing
View Details