Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD278 Recombinant Protein

CD278 Recombinant Protein

Product Specifications

UniProt

Q9Y6W8

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~15kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBL7 (NM_032907) Human Tagged ORF Clone Lentiviral Particle
RC204907L4V 200 µL

UBL7 (NM_032907) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRK40 Polyclonal Antibody
MBS9009799 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRK40 Polyclonal Antibody

Sign In for Pricing
View Details
ACTIN Antibody (Muscle)
GWB-4EA566 0.1 mL

ACTIN Antibody (Muscle)

Sign In for Pricing
View Details
Bovine IgD ELISA Kit
EBI0067 96 Tests

Bovine IgD ELISA Kit

Sign In for Pricing
View Details
TRAP100 (MED24) Human Over-expression Lysate
orb1348184 100 µg

TRAP100 (MED24) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIM28 (Tripartite Motif-containing Protein 28, KAP1, TF1B, RNF96, TIF1B) (FITC)
MBS6441690-01 0.1 mL

TRIM28 (Tripartite Motif-containing Protein 28, KAP1, TF1B, RNF96, TIF1B) (FITC)

Sign In for Pricing
View Details