Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD278 Recombinant Protein

CD278 Recombinant Protein

Product Specifications

UniProt

Q9Y6W8

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~15kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RA (Leukocyte Common Antigen, LCA, Ly-5 T200)
C2400-36-01 100 µg

CD45RA (Leukocyte Common Antigen, LCA, Ly-5 T200)

Sign In for Pricing
View Details
CD45RA (Leukocyte Common Antigen, LCA, Ly-5 T200)
C2400-36-02 1 mg

CD45RA (Leukocyte Common Antigen, LCA, Ly-5 T200)

Sign In for Pricing
View Details
Brain Injury Derived Neurotrophic Peptide
E-PP-0865-01 10 mg

Brain Injury Derived Neurotrophic Peptide

Sign In for Pricing
View Details
Brain Injury Derived Neurotrophic Peptide
E-PP-0865-02 100 mg

Brain Injury Derived Neurotrophic Peptide

Sign In for Pricing
View Details
Brain Injury Derived Neurotrophic Peptide
E-PP-0865-03 5 mg

Brain Injury Derived Neurotrophic Peptide

Sign In for Pricing
View Details
N-(3-Amino[1,1'-biphenyl]-4-yl)-carbamic Acid tert-Butyl Ester
TRC-A601620-50MG 50 mg

N-(3-Amino[1,1'-biphenyl]-4-yl)-carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details