Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD23A Recombinant Protein

CD23A Recombinant Protein

Product Specifications

UniProt

P06734

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~35kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-bromo-8-fluorodibenzo[b, d]furan
JH920041 1 Each

2-bromo-8-fluorodibenzo[b, d]furan

Sign In for Pricing
View Details
RPL9P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1895108 1.0 µg DNA

RPL9P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
C18orf15 Human shRNA Lentiviral Particle (Locus ID 147276)
TL317930V 500 µL Each

C18orf15 Human shRNA Lentiviral Particle (Locus ID 147276)

Sign In for Pricing
View Details
Phospho-Catenin 1 (Ser320) Antibody
MBS8529016-01 0.1 mg

Phospho-Catenin 1 (Ser320) Antibody

Sign In for Pricing
View Details
Phospho-Catenin 1 (Ser320) Antibody
MBS8529016-02 0.1 mL (AF635)

Phospho-Catenin 1 (Ser320) Antibody

Sign In for Pricing
View Details
Phospho-Catenin 1 (Ser320) Antibody
MBS8529016-03 0.1 mL (AF610)

Phospho-Catenin 1 (Ser320) Antibody

Sign In for Pricing
View Details