Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD23A Recombinant Protein

CD23A Recombinant Protein

Product Specifications

UniProt

P06734

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~35kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMX/hnRNP G polyclonal antibody
BS76312-01 50 µL

RBMX/hnRNP G polyclonal antibody

Sign In for Pricing
View Details
RBMX/hnRNP G polyclonal antibody
BS76312-02 100 µL

RBMX/hnRNP G polyclonal antibody

Sign In for Pricing
View Details
Med27 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6480705 3x 1.0 µg

Med27 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
NXPH3 cDNA Clone
MBS1278270-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

NXPH3 cDNA Clone

Sign In for Pricing
View Details
NXPH3 cDNA Clone
MBS1278270-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

NXPH3 cDNA Clone

Sign In for Pricing
View Details
B-Cell CLL/lymphoma 9-Like protein (Bcl-9L) Mouse ELISA Kit
B7697 96 Tests

B-Cell CLL/lymphoma 9-Like protein (Bcl-9L) Mouse ELISA Kit

Sign In for Pricing
View Details