Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD23A Recombinant Protein

CD23A Recombinant Protein

Product Specifications

UniProt

P06734

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~35kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

40110049-1
40121221-2 250 mL

40110049-1

Sign In for Pricing
View Details
ZAP70 (NM_001079) Human Tagged ORF Clone Lentiviral Particle
RC208838L2V 200 µL

ZAP70 (NM_001079) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CysLT1 Rabbit Polyclonal Antibody (HRP)
orb477948 100 µL

CysLT1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TMEM173 (Mitochondrial Transmembrane Protein 173 EMBL AEM66211.1, Transmembrane Protein 173)
494067 100 µL

TMEM173 (Mitochondrial Transmembrane Protein 173 EMBL AEM66211.1, Transmembrane Protein 173)

Sign In for Pricing
View Details
MYO3B 3'UTR GFP Stable Cell Line
TU065086 1.0 mL

MYO3B 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Goat Filamin Binding LIM Protein 1 ELISA Kit
MBS096334 Inquire

Goat Filamin Binding LIM Protein 1 ELISA Kit

Sign In for Pricing
View Details