Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD174 Recombinant Protein

CD174 Recombinant Protein

Product Specifications

UniProt

P21217

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~42kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC25A22 siRNA
abx933705-01 15 nmol

Human SLC25A22 siRNA

Sign In for Pricing
View Details
Human SLC25A22 siRNA
abx933705-02 30 nmol

Human SLC25A22 siRNA

Sign In for Pricing
View Details
Arhgap17 ORF Vector (Mouse) (pORF)
ORF038927 1.0 µg DNA

Arhgap17 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
AKR7A2 3'UTR Luciferase Stable Cell Line
TU000584 1.0 mL

AKR7A2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rsrp1 (NM_023665) Mouse Tagged ORF Clone Lentiviral Particle
MR203131L4V 200 µL

Rsrp1 (NM_023665) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Galectin-10 Alexa Fluor 488 Antibody (Clone 561603)
FAB5447G-100UG 100 µg

Human Galectin-10 Alexa Fluor 488 Antibody (Clone 561603)

Sign In for Pricing
View Details