Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD174 Recombinant Protein

CD174 Recombinant Protein

Product Specifications

UniProt

P21217

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~42kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSF2/GM-CSF Protein, His Tag
KMPH1139 5 µg

Human CSF2/GM-CSF Protein, His Tag

Sign In for Pricing
View Details
INT11 (CPSF3L) (NM_001256456) Human Tagged ORF Clone
RC233007 10 µg

INT11 (CPSF3L) (NM_001256456) Human Tagged ORF Clone

Sign In for Pricing
View Details
(S) -Tetrahydrofuran-3-amine hydrochloride
S3990-01 250 mg

(S) -Tetrahydrofuran-3-amine hydrochloride

Sign In for Pricing
View Details
(S) -Tetrahydrofuran-3-amine hydrochloride
S3990-02 1 g

(S) -Tetrahydrofuran-3-amine hydrochloride

Sign In for Pricing
View Details
CAPG Antibody (Center) Blocking Peptide
MBS9221400-01 0.5 mg

CAPG Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
CAPG Antibody (Center) Blocking Peptide
MBS9221400-02 5x 0.5 mg

CAPG Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details