Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD90 Recombinant Protein

CD90 Recombinant Protein

Product Specifications

UniProt

P04216

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~17kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S) -1- (4- (Cyclopentyloxy) phenyl) ethan-1-amine hydrochloride
OR1047201-01 100 mg

(S) -1- (4- (Cyclopentyloxy) phenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
(S) -1- (4- (Cyclopentyloxy) phenyl) ethan-1-amine hydrochloride
OR1047201-02 250 mg

(S) -1- (4- (Cyclopentyloxy) phenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
(S) -1- (4- (Cyclopentyloxy) phenyl) ethan-1-amine hydrochloride
OR1047201-03 1 g

(S) -1- (4- (Cyclopentyloxy) phenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
STYXL2 Human Over-expression Lysate
orb1363921 20 µg

STYXL2 Human Over-expression Lysate

Sign In for Pricing
View Details
SUCLA2 Protein Vector (Mouse) (pPB-C-His)
PV235114 500 ng

SUCLA2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Regulatory protein E2 (E2)
MBS1175456-01 0.02 mg (E-Coli)

Recombinant Regulatory protein E2 (E2)

Sign In for Pricing
View Details