Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD90 Recombinant Protein

CD90 Recombinant Protein

Product Specifications

UniProt

P04216

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~17kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DNA-PK (phospho-Y2609) PRKDC Antibody
A00645Y2609 100 µL

Anti-DNA-PK (phospho-Y2609) PRKDC Antibody

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C11orf70 homolog
MBS1432059-01 0.02 mg (E-Coli)

Recombinant Rat Uncharacterized protein C11orf70 homolog

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C11orf70 homolog
MBS1432059-02 0.02 mg (Yeast)

Recombinant Rat Uncharacterized protein C11orf70 homolog

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C11orf70 homolog
MBS1432059-03 0.1 mg (E-Coli)

Recombinant Rat Uncharacterized protein C11orf70 homolog

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C11orf70 homolog
MBS1432059-04 0.1 mg (Yeast)

Recombinant Rat Uncharacterized protein C11orf70 homolog

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C11orf70 homolog
MBS1432059-05 0.02 mg (Baculovirus)

Recombinant Rat Uncharacterized protein C11orf70 homolog

Sign In for Pricing
View Details