What is the catalog number for CD90 Recombinant Protein?

The catalog number for CD90 Recombinant Protein is orb1495150.

What sizes are available for CD90 Recombinant Protein?

CD90 Recombinant Protein is available in the following size(s): 500 µg, 1 mg.

How many pack sizes does CD90 Recombinant Protein come in?

CD90 Recombinant Protein is available in 2 different pack sizes.

Is CD90 Recombinant Protein in stock?

CD90 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

CD90 Recombinant Protein

Product Specifications

UniProt

P04216

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~17kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV247966 500 ng

YBEY Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing

View Details

bsm-33236M-PerCP 100 µL

AMPK alpha-1 Monoclonal Antibody, PerCP Conjugated

Sign In for Pricing

View Details

531340-01 20 µL

PAK1IP1 discontinued

Sign In for Pricing

View Details

531340-02 100 µL

PAK1IP1 discontinued

Sign In for Pricing

View Details

C04989-100ul 100 µL

Phospho-Tau (Ser202/ Thr205) Mouse mAb

Sign In for Pricing

View Details

SC101257 10 µg

EZH2 (NM_152998) Human Untagged Clone

Sign In for Pricing

View Details