Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD265 Recombinant Protein

CD265 Recombinant Protein

Product Specifications

UniProt

Q9Y6Q6

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~21kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human FOXP3 Monoclonal Antibody (1A210)
MHJ52503 100 μg

Anti-Human FOXP3 Monoclonal Antibody (1A210)

Sign In for Pricing
View Details
Hamster Hamartin (TSC1) ELISA Kit
MBS9380613-01 48 Well

Hamster Hamartin (TSC1) ELISA Kit

Sign In for Pricing
View Details
Hamster Hamartin (TSC1) ELISA Kit
MBS9380613-02 96 Well

Hamster Hamartin (TSC1) ELISA Kit

Sign In for Pricing
View Details
Hamster Hamartin (TSC1) ELISA Kit
MBS9380613-03 5x 96 Well

Hamster Hamartin (TSC1) ELISA Kit

Sign In for Pricing
View Details
Hamster Hamartin (TSC1) ELISA Kit
MBS9380613-04 10x 96 Well

Hamster Hamartin (TSC1) ELISA Kit

Sign In for Pricing
View Details
FAS Blocking Peptide
33R-3398 0.1 mg

FAS Blocking Peptide

Sign In for Pricing
View Details