Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD265 Recombinant Protein

CD265 Recombinant Protein

Product Specifications

UniProt

Q9Y6Q6

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~21kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHFPL3 Rabbit Polyclonal Antibody (PerCP)
orb2482132 100 µL

LHFPL3 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
GPD2 Rabbit Polyclonal Antibody
orb341129-01 30 µL

GPD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPD2 Rabbit Polyclonal Antibody
orb341129-02 50 μL

GPD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPD2 Rabbit Polyclonal Antibody
orb341129-03 100 µL

GPD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPD2 Rabbit Polyclonal Antibody
orb341129-04 200 µL

GPD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fibronectin, Cellular (cFn, FN, FN1, Cold-insoluble Globulin, CIG, DKFZp686F10164, DKFZp686H0342, DKFZp686I1370, DKFZp686O13149, ED-B, FINC, FNZ, GFND, GFND2, LETS, MSF)
MBS632161-01 0.1 mg

Fibronectin, Cellular (cFn, FN, FN1, Cold-insoluble Globulin, CIG, DKFZp686F10164, DKFZp686H0342, DKFZp686I1370, DKFZp686O13149, ED-B, FINC, FNZ, GFND, GFND2, LETS, MSF)

Sign In for Pricing
View Details