Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD303 Recombinant Protein

CD303 Recombinant Protein

Product Specifications

UniProt

Q8WTT0

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~23kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Hmgcr Pre-designed siRNA Set B
SI206292B 1 Each

Rat Hmgcr Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Human HLA-DRA/DRB4 Antibody (GPC-8-18)
ARO-A17795 100 µg

Anti-Human HLA-DRA/DRB4 Antibody (GPC-8-18)

Sign In for Pricing
View Details
FAM71F2 siRNA (Rat)
CRR6597-01 15 nmol

FAM71F2 siRNA (Rat)

Sign In for Pricing
View Details
FAM71F2 siRNA (Rat)
CRR6597-02 30 nmol

FAM71F2 siRNA (Rat)

Sign In for Pricing
View Details
Human CHAMP1 qPCR Primer Pair
QH70813S 200 Tests

Human CHAMP1 qPCR Primer Pair

Sign In for Pricing
View Details
Pentachlorophenol sodium (PCS) Rapid Test Kit
SC-SC-011 20 Tests/Box

Pentachlorophenol sodium (PCS) Rapid Test Kit

Sign In for Pricing
View Details