Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD303 Recombinant Protein

CD303 Recombinant Protein

Product Specifications

UniProt

Q8WTT0

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~23kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse ER Lumen Protein Retaining Receptor 3 (KDELR3) ELISA Kit
MBS9944197-01 48 Well

Horse ER Lumen Protein Retaining Receptor 3 (KDELR3) ELISA Kit

Sign In for Pricing
View Details
Horse ER Lumen Protein Retaining Receptor 3 (KDELR3) ELISA Kit
MBS9944197-02 96 Well

Horse ER Lumen Protein Retaining Receptor 3 (KDELR3) ELISA Kit

Sign In for Pricing
View Details
Horse ER Lumen Protein Retaining Receptor 3 (KDELR3) ELISA Kit
MBS9944197-03 5x 96 Well

Horse ER Lumen Protein Retaining Receptor 3 (KDELR3) ELISA Kit

Sign In for Pricing
View Details
Horse ER Lumen Protein Retaining Receptor 3 (KDELR3) ELISA Kit
MBS9944197-04 10x 96 Well

Horse ER Lumen Protein Retaining Receptor 3 (KDELR3) ELISA Kit

Sign In for Pricing
View Details
FLVC1 Polyclonal Antibody
MBS8531819-01 0.1 mg

FLVC1 Polyclonal Antibody

Sign In for Pricing
View Details
FLVC1 Polyclonal Antibody
MBS8531819-02 0.1 mL (AF635)

FLVC1 Polyclonal Antibody

Sign In for Pricing
View Details