Recombinant Human Brain Natriuretic Peptide (rHuBNP)
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Product Specifications
Source
Escherichia coli.
Field of Research
Neuroscience; Cardiovascular Research
Endotoxin
Less than 1EU/g of rHuCNTF as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Data Not Available.
Form
Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.
Molecular Weight
3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.
Storage Conditions
Notes
For research use only.
Applications Notes
Preservative
Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.
AA Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Lentiviral human HCK sgRNA gene knockout kit - Lentiviral human HCK sgRNA gene knockout kit (25)
