Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain Natriuretic Peptide (rHuBNP)

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.

Product Specifications

Source

Escherichia coli.

Field of Research

Neuroscience; Cardiovascular Research

Endotoxin

Less than 1EU/g of rHuCNTF as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Data Not Available.

Form

Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.

Molecular Weight

3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.

AA Sequence

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHIP-2 (E-2)
sc-166641 200 µg/mL

SHIP-2 (E-2)

Sign In for Pricing
View Details
Human XPR1 activation kit by CRISPRa
GA106143 1 Kit

Human XPR1 activation kit by CRISPRa

Sign In for Pricing
View Details
SFRP4, Recombinant, Human (Secreted Frizzled Related Protein 4, DDC-4, FrpAP, frpHE, FrzB-2) (BSA Free)
S1012-89RX 25 µg

SFRP4, Recombinant, Human (Secreted Frizzled Related Protein 4, DDC-4, FrpAP, frpHE, FrzB-2) (BSA Free)

Sign In for Pricing
View Details
Mouse Protein HEXIM1, Hexim1 ELISA KIT
ELI-14366m 96 Tests

Mouse Protein HEXIM1, Hexim1 ELISA KIT

Sign In for Pricing
View Details
Recombinant Zea mays Tubulin beta-4 chain (TUBB4)
MBS1415967-01 0.02 mg (E-Coli)

Recombinant Zea mays Tubulin beta-4 chain (TUBB4)

Sign In for Pricing
View Details
Recombinant Zea mays Tubulin beta-4 chain (TUBB4)
MBS1415967-02 0.02 mg (Yeast)

Recombinant Zea mays Tubulin beta-4 chain (TUBB4)

Sign In for Pricing
View Details