Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ENA-78 (5-78a.a.) (rHuENA-78 (CXCL5) )

Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.

Product Specifications

Source

Escherichia coli.

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1EU/mg of rHuENA-78/CXCL5 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-10.0 ng/ml, corresponding to a Specific Activity of >1 x 105 IU/mg.

Form

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

Molecular Weight

8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

AA Sequence

AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-100 1x 100 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details