Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYY Antibody Blocking Peptide

This product is PYY Antibody Blocking Peptide. Its protein sequence is YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2. It targets Peptide YY. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

RATGHYY; GHYY; MGC19143; Peptide tyrosine tyrosine; peptide YY; Peptide YY like; Peptide YY precursor; PYY 1; PYY; PYY II; PYY1; PYYI; Yy; PYY_HUMAN.

Field of Research

Hormone Research, Obesity

Form

Lyophilized

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC3 Polyclonal Antibody, APC-Cy7 Conjugated
bs-10024R-APC-Cy7 100 µL

HDAC3 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Anti-Phospho-PKC Alpha/PRKCA (S657) Antibody
P00743-1 100 µL

Anti-Phospho-PKC Alpha/PRKCA (S657) Antibody

Sign In for Pricing
View Details
ELISA kit for Human ENG (Endoglin)
E-EL-H0062 96 Tests

ELISA kit for Human ENG (Endoglin)

Sign In for Pricing
View Details
ADAM12
554437-01 50 µg

ADAM12

Sign In for Pricing
View Details
ADAM12
554437-02 100 µg

ADAM12

Sign In for Pricing
View Details
Anti-HOXD10 Antibody Picoband® Fluoro550 Conjugated
A05257-2-Fluoro550 100 µg/Vial

Anti-HOXD10 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details