Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD235a Recombinant Protein

CD235a Recombinant Protein

Product Specifications

UniProt

P02724

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~11kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MSSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD4 Recombinant Protein (C-Fc)
MF998021-01 50 µg

Mouse CD4 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Mouse CD4 Recombinant Protein (C-Fc)
MF998021-02 100 µg

Mouse CD4 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Mouse CD4 Recombinant Protein (C-Fc)
MF998021-03 1 mg

Mouse CD4 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
AFG3L2 (AFG3-Like Protein 2, AFG3-Like Protein 2, SCA28, Spinocerebellar Ataxia 28)
305133 100 µL

AFG3L2 (AFG3-Like Protein 2, AFG3-Like Protein 2, SCA28, Spinocerebellar Ataxia 28)

Sign In for Pricing
View Details
DNER Antibody Fluoro594 Conjugated
orb3156513 100 µg

DNER Antibody Fluoro594 Conjugated

Sign In for Pricing
View Details
BMPR1A, NT (Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Serine/Threonine-protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, CD292, ACVRLK3, ALK3) (Biotin) discontinued
B2553-62D-Biotin 200 µL

BMPR1A, NT (Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Serine/Threonine-protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, CD292, ACVRLK3, ALK3) (Biotin) discontinued

Sign In for Pricing
View Details