Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD208 Recombinant Protein

CD208 Recombinant Protein

Product Specifications

UniProt

Q9UQV4

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~47kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Rel (Ser503) Antibody
MBS9601164-01 0.1 mL

Phospho-Rel (Ser503) Antibody

Sign In for Pricing
View Details
Phospho-Rel (Ser503) Antibody
MBS9601164-02 0.2 mL

Phospho-Rel (Ser503) Antibody

Sign In for Pricing
View Details
Phospho-Rel (Ser503) Antibody
MBS9601164-03 5x 0.2 mL

Phospho-Rel (Ser503) Antibody

Sign In for Pricing
View Details
(R) -2- (Pyrrolidin-2-Yl) acetamide hydrochloride
OR1039042-01 100 mg

(R) -2- (Pyrrolidin-2-Yl) acetamide hydrochloride

Sign In for Pricing
View Details
(R) -2- (Pyrrolidin-2-Yl) acetamide hydrochloride
OR1039042-02 250 mg

(R) -2- (Pyrrolidin-2-Yl) acetamide hydrochloride

Sign In for Pricing
View Details
(R) -2- (Pyrrolidin-2-Yl) acetamide hydrochloride
OR1039042-03 1 g

(R) -2- (Pyrrolidin-2-Yl) acetamide hydrochloride

Sign In for Pricing
View Details