Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD208 Recombinant Protein

CD208 Recombinant Protein

Product Specifications

UniProt

Q9UQV4

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~47kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dolichos biflorus Lectin (DBA) - Pure
21510042-2 10 mg

Dolichos biflorus Lectin (DBA) - Pure

Sign In for Pricing
View Details
1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one
orb3172201-01 1 mg

1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one

Sign In for Pricing
View Details
1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one
orb3172201-02 2 mg

1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one

Sign In for Pricing
View Details
1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one
orb3172201-03 3 mg

1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one

Sign In for Pricing
View Details
1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one
orb3172201-04 4 mg

1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one

Sign In for Pricing
View Details
1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one
orb3172201-05 5 mg

1-[ (5E) -hept-5-en-1-yl]-1-hydroxy-7a- (hydroxymethyl) -2-methyl-hexahydro-1H-pyrrolizin-3-one

Sign In for Pricing
View Details