Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD274 Recombinant Protein

CD274 Recombinant Protein

Product Specifications

UniProt

Q9NZQ7

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~30kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RPN2 Antibody Picoband®, PE Conjugate
A05006-1-PE 100 µg/Vial

Anti-RPN2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
MSX1 (msh Homeobox 1, HOX7, HYD1) (MaxLight 550)
248974-ML550 100 µL

MSX1 (msh Homeobox 1, HOX7, HYD1) (MaxLight 550)

Sign In for Pricing
View Details
6-Bromophthalazin-1 (2H) -one
orb3022804-01 50 mg

6-Bromophthalazin-1 (2H) -one

Sign In for Pricing
View Details
6-Bromophthalazin-1 (2H) -one
orb3022804-02 200 mg

6-Bromophthalazin-1 (2H) -one

Sign In for Pricing
View Details
MXRA8 ELISA Kit (Human) (OKCA01352)
OKCA01352 96 Well

MXRA8 ELISA Kit (Human) (OKCA01352)

Sign In for Pricing
View Details
KLHDC7A (NM_152375) Human Tagged Lenti ORF Clone
RC215444L3 10 µg

KLHDC7A (NM_152375) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details