Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD274 Recombinant Protein

CD274 Recombinant Protein

Product Specifications

UniProt

Q9NZQ7

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~30kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rer1 shRNA (UAS) - Lentiviral mouse Rer1 shRNA (UAS, iRFP) (25)
GTR15214478 1 Vial

Lentiviral mouse Rer1 shRNA (UAS) - Lentiviral mouse Rer1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rabbit anti-human Complement C4-B polyclonal Antibody, Biotin conjugated
MBS1497416-01 0.05 mg

Rabbit anti-human Complement C4-B polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Complement C4-B polyclonal Antibody, Biotin conjugated
MBS1497416-02 0.1 mg

Rabbit anti-human Complement C4-B polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Complement C4-B polyclonal Antibody, Biotin conjugated
MBS1497416-03 5x 0.1 mg

Rabbit anti-human Complement C4-B polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
SU 5402
T6996-01 1 mg

SU 5402

Sign In for Pricing
View Details
SU 5402
T6996-02 5 mg

SU 5402

Sign In for Pricing
View Details