Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine NOGGIN (rMuNOGGIN)

Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2, -7, -13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis.

Product Specifications

Source

Escherichia coli.

Endotoxin

Less than 1EU/mg of rMuNOGGIN as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses.

Bioactivity

Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 1.0-2.0 ng/ml of Noggin, corresponding to a Specific Activity of >5 x 105 IU/mg.

Form

Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.

Molecular Weight

Approximately 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.

AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSV PEGMVCKPSK SVHLTVLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF647 conjugate, 0.1mg/mL
BNC472617-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS507032 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
SOS2 Human Gene Knockout Kit (CRISPR)
KN418160 1 Kit

SOS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Ileum
CR561311 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
p53 (TP53) Rabbit Polyclonal Antibody
AP21105PU-N 100 µg

p53 (TP53) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GranULin (GRN) Human Gene Knockout Kit (CRISPR)
KN202139RB 1 Kit

GranULin (GRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details