Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine Tumor Necrosis Factor-alpha (rMuTNF-α)

Tumor necrosis factor alpha (TNF-α) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. Mouse TNF-α occurs as a membrane-anchored form. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. The biologically active native form of TNF-α is reportedly a trimer. Human and murine TNF-α show approximately 79% homology at the amino acid level and crossreactivity between the two species.

Product Specifications

Source

Escherichia coli.

Field of Research

Cancer Biology; Immunology & Inflammation

Endotoxin

Less than 1EU/mg of rMuTNF-α as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is 1x107 units/mg.

Form

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.2.

Molecular Weight

Approximately 17.3 kDa. The recombinant murine TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.2.

AA Sequence

MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN22, ID (CLDN22, Claudin-22) (FITC) discontinued
033964-FITC 200 µL

CLDN22, ID (CLDN22, Claudin-22) (FITC) discontinued

Sign In for Pricing
View Details
BID Antibody
orb1557473-01 50 μL

BID Antibody

Sign In for Pricing
View Details
BID Antibody
orb1557473-02 100 µL

BID Antibody

Sign In for Pricing
View Details
BID Antibody
orb1557473-03 200 µL

BID Antibody

Sign In for Pricing
View Details
XIC Protein Lysate (Human) with C-Ha Tag
50518031 100 µg

XIC Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Krtap6-2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3421004 1.0 µg DNA

Krtap6-2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details