Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTRAIL/Apo2L, Human

TRAIL/Apo2L, also known as Tumor Necrosis Factor Super-Family 10 (TNFSF10), is a pleiotropic cytokine thatbelongs to the TNF superfamily. The full length TRAIL expressed in vivo is a Type II transmembrane protein, although the soluble form also exists and functions. TRAIL has four major receptors: two death receptors DR4 and DR5, two decoy receptors DcR1 and DcR2. TRAIL binds to the death receptors, recruits the FAS-associated death domain, activates caspases 8 and 10, and eventually leads to apoptosis. Because of its antitumor potential, TRAIL is actively studied as a therapeutic agent. On the other hand, abnormal expression of TRAIL in small arteries can induce the proliferation of smooth muscle cells, resulting in increasing vascular remodeling and pulmonary arterial hypertension. Recombinant human TRAIL/Apo2L (rhTRAIL) produced in E.coli is a single non-glycosylated polypeptide chain containing 169 amino acids. A fully biologically active molecule, rhTRAIL has a molecular mass of 19.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

TNF-related apoptosis-inducing Ligand, TNFSF10, Apo2 Ligand, TL2

Source

Escherichia coli.

Field of Research

Cell Biology

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2.5 x 10ˆ4 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

19.6 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human TRAIL/Apo2L (rhTRAIL) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhTRAIL remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

MVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGE LVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSK DAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eukaryotic aspartyl protease Rabbit Polyclonal Antibody (BF555)
orb2557251 100 µL

Eukaryotic aspartyl protease Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Rat P-Selectin ELISA Kit
MBS3807656-01 48 Well

Rat P-Selectin ELISA Kit

Sign In for Pricing
View Details
Rat P-Selectin ELISA Kit
MBS3807656-02 96 Well

Rat P-Selectin ELISA Kit

Sign In for Pricing
View Details
Rat P-Selectin ELISA Kit
MBS3807656-03 5x 96 Well

Rat P-Selectin ELISA Kit

Sign In for Pricing
View Details
Rat P-Selectin ELISA Kit
MBS3807656-04 10x 96 Well

Rat P-Selectin ELISA Kit

Sign In for Pricing
View Details
Methyl 2-[ (oxan-4-yl) amino]acetate hydrochloride
FDD51605-01 100 mg

Methyl 2-[ (oxan-4-yl) amino]acetate hydrochloride

Sign In for Pricing
View Details