Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantAdiponectin, Human (CHO-expressed)

Adiponectin is an important adipokine involved in the control of fat metabolism and insulin sensitivity. It is synthesized exclusively by adipocytes and secreted into plasma. It antagonizes THF-alpha by negatively regulating its expression. It also inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin can form low molecular weight complexes (LMW), middle molecular weight complexes (MMW) and higher molecular weight complexes (HMW) . These bind to various growth factors, such as HBEGF, PDGFB and FGF2, and play a role in cell growth, angiogenesis and tissue remodeling.

Product Specifications

Product Name Alternative

Acrp-30, Acrp-30, GBP-28, GBP28, Apm-1

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 2ng/ml, measured in a cell growth inhibition assay using M1 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Adiponectin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adiponectinshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQ GRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKK DKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leupeptin Hemisulfate
41200020-2 25 mg

Leupeptin Hemisulfate

Sign In for Pricing
View Details
Mouse Monoclonal RuvA Antibody (RuvA 12C6) [DyLight 550]
NBP2-50278R 0.1 mL

Mouse Monoclonal RuvA Antibody (RuvA 12C6) [DyLight 550]

Sign In for Pricing
View Details
PLC gamma 1 (PLCG1) Rabbit pAb
A21545 200 µL

PLC gamma 1 (PLCG1) Rabbit pAb

Sign In for Pricing
View Details
Human Olfactory receptor 52I1 (OR52I1) ELISA Kit
GTR10353174 96 Well

Human Olfactory receptor 52I1 (OR52I1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Clostridium acetobutylicum Argininosuccinate synthase (argG)
MBS1476347-01 0.02 mg (E-Coli)

Recombinant Clostridium acetobutylicum Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Clostridium acetobutylicum Argininosuccinate synthase (argG)
MBS1476347-02 0.02 mg (Yeast)

Recombinant Clostridium acetobutylicum Argininosuccinate synthase (argG)

Sign In for Pricing
View Details