Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantAdiponectin, Human (CHO-expressed)

Adiponectin is an important adipokine involved in the control of fat metabolism and insulin sensitivity. It is synthesized exclusively by adipocytes and secreted into plasma. It antagonizes THF-alpha by negatively regulating its expression. It also inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin can form low molecular weight complexes (LMW), middle molecular weight complexes (MMW) and higher molecular weight complexes (HMW) . These bind to various growth factors, such as HBEGF, PDGFB and FGF2, and play a role in cell growth, angiogenesis and tissue remodeling.

Product Specifications

Product Name Alternative

Acrp-30, Acrp-30, GBP-28, GBP28, Apm-1

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 2ng/ml, measured in a cell growth inhibition assay using M1 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Adiponectin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adiponectinshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQ GRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKK DKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-1-fluoro-4- (2,2,2-trifluoroethyl) -benzene
sc-307339 1 g

2-Chloro-1-fluoro-4- (2,2,2-trifluoroethyl) -benzene

Sign In for Pricing
View Details
CD146 Recombinant Antibody, Cy5 Conjugated
bsm-61136R-Cy5-TR 20 µL

CD146 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & hFc)
TMPY-00934-01 5 µg

TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & hFc)

Sign In for Pricing
View Details
TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & hFc)
TMPY-00934-02 10 µg

TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & hFc)

Sign In for Pricing
View Details
TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & hFc)
TMPY-00934-03 20 µg

TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & hFc)

Sign In for Pricing
View Details
TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & hFc)
TMPY-00934-04 50 µg

TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & hFc)

Sign In for Pricing
View Details