Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantCINC-2α/CXCL3, Rat

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as MIP2β (macrophage inflammatory protein 2 beta), or DCIP1 (dendritic cell inflammatory protein1) in mouse, CINC-2 (cytokineinduced neutrophil attractant 2) in rat, or GROγ (growthregulated oncogene gamma) in human. CXCL3 controls migration and adhesion of monocytes and mediates its effects on target cells by interacting with the cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates cerebellar granule neuron precursors toward the internal layers of the cerebellum during cerebellum morphogenesis. CXCL3 is a potential target for medulloblastoma therapy. CXCL3 is regulated transcriptionally by BTG2.Recombinant Rat CINC-2α/CXCL3 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rrCINC-2α/CXCL3 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Growth Regulated Protein/Melanoma Growth Stimulatory Activity (MGSA γ), CXCL3, GRO gamma, CINC‐2, DCIP‐1, GRO3

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of rat CINC‐2α/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/rCXCR2 cells (human G15 and ratCXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

7.6 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat CINC-2α/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat CINC-2α/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPN5 Antibody
CSB-PA740895LA01HU-01 50 µg

OPN5 Antibody

Sign In for Pricing
View Details
OPN5 Antibody
CSB-PA740895LA01HU-02 100 µg

OPN5 Antibody

Sign In for Pricing
View Details
TRIP1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-7731R-APC-Cy5.5 100 µL

TRIP1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Human TRAF5, N-His
MBS1572460-01 0.1 mg

Recombinant Human TRAF5, N-His

Sign In for Pricing
View Details
Recombinant Human TRAF5, N-His
MBS1572460-02 1 mg

Recombinant Human TRAF5, N-His

Sign In for Pricing
View Details
Recombinant Human TRAF5, N-His
MBS1572460-03 5x 1 mg

Recombinant Human TRAF5, N-His

Sign In for Pricing
View Details