RecombinantCINC-2α/CXCL3, Rat
Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as MIP2β (macrophage inflammatory protein 2 beta), or DCIP1 (dendritic cell inflammatory protein1) in mouse, CINC-2 (cytokineinduced neutrophil attractant 2) in rat, or GROγ (growthregulated oncogene gamma) in human. CXCL3 controls migration and adhesion of monocytes and mediates its effects on target cells by interacting with the cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates cerebellar granule neuron precursors toward the internal layers of the cerebellum during cerebellum morphogenesis. CXCL3 is a potential target for medulloblastoma therapy. CXCL3 is regulated transcriptionally by BTG2.Recombinant Rat CINC-2α/CXCL3 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rrCINC-2α/CXCL3 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Specifications
Product Name Alternative
Growth Regulated Protein/Melanoma Growth Stimulatory Activity (MGSA γ), CXCL3, GRO gamma, CINC‐2, DCIP‐1, GRO3
Source
CHO
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
7.6 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog