Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantDCIP-1/CXCL3, Mouse

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP­2b. CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of cerebellum, during morphogenesis. Recombinant mouse DCIP-1/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmDCIP-1/CXCL3 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

DCIP-1, CXCL3

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of mouse DCIP-1/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/mCXCR2 cells (human Ga15 and mouse CXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse DCIP-1°CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse DCIP-1°CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2E1 Human Gene Knockout Kit (CRISPR)
KN207015 1 Kit

NR2E1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPS15AP37 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
42136061 1.0 µg DNA

RPS15AP37 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ATP5E sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0148005 3x 1.0 µg

ATP5E sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii panC Protein (aa 1-311)
VAng-Yyj5300-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Vanbaalenii panC Protein (aa 1-311)

Sign In for Pricing
View Details
KPNA6 Rabbit pAb
E45R27329N-100 100 µL

KPNA6 Rabbit pAb

Sign In for Pricing
View Details
Agitoxin-2
TP2089 5 mg

Agitoxin-2

Sign In for Pricing
View Details