Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantEGF, Rat (CHO-expressed)

Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Receptor (EGFR) and stimulating downstream protein tyrosine kinase activity. This signal transduction cascade results in increased intracellular calcium levels and increased rates of glycolysis and protein synthesis. EGF stimulates the growth of many epidermal and epithelial tissues. Pharmaceutical drugs designed to inhibit EGFR have been used to treat certain types of cancer.

Product Specifications

Product Name Alternative

Epidermal Growth Factor

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.1 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

~6 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Epidermal Growth Factor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Epidermal Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN
MBS1055021-01 0.02 mg (E-Coli)

Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN

Sign In for Pricing
View Details
Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN
MBS1055021-02 0.1 mg (E-Coli)

Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN

Sign In for Pricing
View Details
Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN
MBS1055021-03 0.02 mg (Yeast)

Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN

Sign In for Pricing
View Details
Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN
MBS1055021-04 0.1 mg (Yeast)

Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN

Sign In for Pricing
View Details
Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN
MBS1055021-05 0.02 mg (Baculovirus)

Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN

Sign In for Pricing
View Details
Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN
MBS1055021-06 1 mg (E-Coli)

Recombinant Rhodomicrobium vannielii N (2)-fixation sustaining protein CowN

Sign In for Pricing
View Details