Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantEpigen, Human (CHO-expressed)

Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.

Product Specifications

Product Name Alternative

EPG, Epithelial mitogen

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 1 μg/ml, measured in a proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Epigen remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY A

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2LSZH-750-2-YL-3 AB Labels
141185 Roll of 750 Piece(s)

2LSZH-750-2-YL-3 AB Labels

Sign In for Pricing
View Details
Interleukin Enhancer Binding Factor 3 (ILF3) Antibody
abx321444-01 20 µL

Interleukin Enhancer Binding Factor 3 (ILF3) Antibody

Sign In for Pricing
View Details
Interleukin Enhancer Binding Factor 3 (ILF3) Antibody
abx321444-02 50 µL

Interleukin Enhancer Binding Factor 3 (ILF3) Antibody

Sign In for Pricing
View Details
Interleukin Enhancer Binding Factor 3 (ILF3) Antibody
abx321444-03 100 µL

Interleukin Enhancer Binding Factor 3 (ILF3) Antibody

Sign In for Pricing
View Details
Interleukin Enhancer Binding Factor 3 (ILF3) Antibody
abx321444-04 200 µL

Interleukin Enhancer Binding Factor 3 (ILF3) Antibody

Sign In for Pricing
View Details
Interleukin Enhancer Binding Factor 3 (ILF3) Antibody
abx321444-05 1 mL

Interleukin Enhancer Binding Factor 3 (ILF3) Antibody

Sign In for Pricing
View Details