Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantEpigen, Human (CHO-expressed)

Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.

Product Specifications

Product Name Alternative

EPG, Epithelial mitogen

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 1 μg/ml, measured in a proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Epigen remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY A

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Probable DNA dC->dU-editing enzyme APOBEC-3B (APOBEC3B) ELISA Kit
NSL1492Ca 96 Tests

Canine Probable DNA dC->dU-editing enzyme APOBEC-3B (APOBEC3B) ELISA Kit

Sign In for Pricing
View Details
Lithium dodecyl sulfate
LB0569 25g

Lithium dodecyl sulfate

Sign In for Pricing
View Details
Human Syndecan 1 (SDC1) ELISA Kit
orb1663655-01 48 Tests

Human Syndecan 1 (SDC1) ELISA Kit

Sign In for Pricing
View Details
Human Syndecan 1 (SDC1) ELISA Kit
orb1663655-02 96 Tests

Human Syndecan 1 (SDC1) ELISA Kit

Sign In for Pricing
View Details
Ets1 ORF Vector (Rat) (pORF)
19528016 1.0 µg DNA

Ets1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant human CRMP1 protein
ATGP3019-500 500 µg

Recombinant human CRMP1 protein

Sign In for Pricing
View Details