Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantEPO, Human

Erythropoietin (EPO), a glycoprotein produced primarily by the kidney, is the principal factor that regulates erythropoiesis by stimulating the proliferation and differentiation of erythroid progenitor cells. The production of EPO by kidney cells is increased in response to hypoxia or anemia. Recombinant EPO has been approved for the treatment of anemia associated with chronic renal failure as well as for anemia of AZT treated AIDS patients.The cDNAs for EPO have been cloned from human, mouse, canine, etc. The mature proteins from the various species are highly conserved, exhibiting greater than 80% sequence identity at the amino acid level. Human EPO cDNA encodes a 193 amino acid residue precursor protein that is processed to yield a 165 amino acid residue mature protein. EPO contains one O-linked and three N-linked glycosylation sites. Glycosylation of EPO is required for EPO biological activities in vivo. EPO exhibits structural as well as amino sequence identity to the amino terminal 153 amino acid region of thrombopoietin.

Product Specifications

Product Name Alternative

Human EPO-alpha, EPO-alpha, EPO alpha, EPOalpha, h-EPO-alpha, rh-AEPO-alpha, recombinant human EPO-alpha, recombinant EPO-alpha, EPO.

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED501 x 10ˆ6units/mg

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

Mature human EPO, containing 166 amino acid residues, has a predicted molecular mass of approximately 21 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 26-36 kDa in SDS-PAGE.

Storage Conditions

Lyophilized recombinant human EPO remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhEPO should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAL LVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEA CRTGDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synrg 3'UTR GFP Stable Cell Line
TU170030 1.0 mL

Synrg 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
3- (2-Chloroacetyl) -1- (2-methylpropyl) urea
KXA99527-01 250 mg

3- (2-Chloroacetyl) -1- (2-methylpropyl) urea

Sign In for Pricing
View Details
3- (2-Chloroacetyl) -1- (2-methylpropyl) urea
KXA99527-02 2.5 g

3- (2-Chloroacetyl) -1- (2-methylpropyl) urea

Sign In for Pricing
View Details
Recombinant Human LILRB1 (C-Fc)
PHH2246-01 10 µg

Recombinant Human LILRB1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human LILRB1 (C-Fc)
PHH2246-02 50 µg

Recombinant Human LILRB1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human LILRB1 (C-Fc)
PHH2246-03 500 µg

Recombinant Human LILRB1 (C-Fc)

Sign In for Pricing
View Details