Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFGF-16, Human

Fibroblast Growth Factor-16 (FGF-16) is a heparin binding growth factor, a member of the FGF family. All FGF family members are heparin­binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The rat homolog is predominantly expressed in embryonic brown adipose tissue and has significant mitogenic activity, which suggests a role in proliferation of embryonic brown adipose tissue. FGF-16 is most similar to FGF-9 (73 % amino acid identity) . The protein sequence of human FGF-16 displays 98.6% identity with rat FGF-16. Chimpanzee FGF-16 (207 amino acids), chicken FGF-16 (207 amino acids), and zebrafish FGF-16 (203 amino acids) show 100 %, 89.9 %, and 79.2 % total amino acid identity with human FGF-16.Recombinant human FGF-16 produced in CHO cells is a polypeptide chain containing 206 amino acids. A fully biologically active molecule, rhFGF-16 has a molecular mass of 23 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

FGF16, Fibroblast Growth Factor-16, FGFG

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Measured in a cell proliferation assay using 3T3 mouse fibroblast cell, The ED50 for this effect is < 20 ng/mL.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Fibroblast Growth Factor-16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fibroblast Growth Factor-16 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTV HGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQY YVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-2 Receptor Subunit alpha/IL-2RA/CD25 Protein (C-Fc)
MBS2552792-01 0.01 mg

Recombinant Human IL-2 Receptor Subunit alpha/IL-2RA/CD25 Protein (C-Fc)

Sign In for Pricing
View Details
Recombinant Human IL-2 Receptor Subunit alpha/IL-2RA/CD25 Protein (C-Fc)
MBS2552792-02 0.05 mg

Recombinant Human IL-2 Receptor Subunit alpha/IL-2RA/CD25 Protein (C-Fc)

Sign In for Pricing
View Details
Recombinant Human IL-2 Receptor Subunit alpha/IL-2RA/CD25 Protein (C-Fc)
MBS2552792-03 5x 0.05 mg

Recombinant Human IL-2 Receptor Subunit alpha/IL-2RA/CD25 Protein (C-Fc)

Sign In for Pricing
View Details
C4BPA Rabbit Polyclonal Antibody (BF680)
orb2508787 100 µL

C4BPA Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
RBM10 Polyclonal Antibody
RD252781A-01 20 µL

RBM10 Polyclonal Antibody

Sign In for Pricing
View Details
RBM10 Polyclonal Antibody
RD252781A-02 60 μL

RBM10 Polyclonal Antibody

Sign In for Pricing
View Details