Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFGF-16, Human

Fibroblast Growth Factor-16 (FGF-16) is a heparin binding growth factor, a member of the FGF family. All FGF family members are heparin­binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The rat homolog is predominantly expressed in embryonic brown adipose tissue and has significant mitogenic activity, which suggests a role in proliferation of embryonic brown adipose tissue. FGF-16 is most similar to FGF-9 (73 % amino acid identity) . The protein sequence of human FGF-16 displays 98.6% identity with rat FGF-16. Chimpanzee FGF-16 (207 amino acids), chicken FGF-16 (207 amino acids), and zebrafish FGF-16 (203 amino acids) show 100 %, 89.9 %, and 79.2 % total amino acid identity with human FGF-16.Recombinant human FGF-16 produced in CHO cells is a polypeptide chain containing 206 amino acids. A fully biologically active molecule, rhFGF-16 has a molecular mass of 23 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

FGF16, Fibroblast Growth Factor-16, FGFG

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Measured in a cell proliferation assay using 3T3 mouse fibroblast cell, The ED50 for this effect is < 20 ng/mL.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Fibroblast Growth Factor-16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fibroblast Growth Factor-16 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTV HGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQY YVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ltbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4199307 1.0 µg DNA

Ltbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human GAMT Recombinant Protein
PPT-12838 100 µg

Human GAMT Recombinant Protein

Sign In for Pricing
View Details
PAXBP1 (NM_013329) Human Tagged Lenti ORF Clone
RC224419L4 10 µg

PAXBP1 (NM_013329) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-TIGD1 / EEYORE antibody
STJ70504 100 µg

Anti-TIGD1 / EEYORE antibody

Sign In for Pricing
View Details
39S ribosomal protein L23 mitochondrial (MRPL23) Rat ELISA Kit
B0690 96 Tests

39S ribosomal protein L23 mitochondrial (MRPL23) Rat ELISA Kit

Sign In for Pricing
View Details
Pbx 2 (1.1) HRP
sc-101853 HRP 200 µg/mL

Pbx 2 (1.1) HRP

Sign In for Pricing
View Details