Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFlt-3L, His, Mouse

Flt3L, also known as Fms-related tyrosine kinase 3 ligand and SL cytokine, is a single-pass type I membrane protein. It is expressed by stromal cells and T cells. Flt3L signals through tyrosine kinase receptor Flt3/Flk2 to stimulate the proliferation of early hematopoietic progenitor cells. It synergizes with other growth factors, such as GM-CSF, IL-3 and CSF, to promote the differentiation of both myeloid and lymphoid cells. Alternative splicing and proteolytic cleavage of membrane-bound Flt3L generates a soluble extracellular domain (ECD) isoform with full biological activity.

Product Specifications

Product Name Alternative

Fms-related tyrosine kinase 3 ligand, SL cytokine

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 10 ng /ml, measured in a cell proliferation assay using AML5 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

24-30 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Flt3L, His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Flt3L, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEI HFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPR PRHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CCR8 Rabbit pAb
GB113737-100 100 μL

Anti-CCR8 Rabbit pAb

Sign In for Pricing
View Details
IL17RB Rabbit Polyclonal Antibody (Cy7)
orb1083769 100 µL

IL17RB Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
TMEM33 Protein Vector (Mouse) (pPM-C-His)
PV239633 500 ng

TMEM33 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
WFDC2 Antibody, mAb, Rabbit
A03438-50 50 µL

WFDC2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Human Sulfatase 1 (SULF1) ELISA Kit
MBS4502692-01 48 Tests

Human Sulfatase 1 (SULF1) ELISA Kit

Sign In for Pricing
View Details
Human Sulfatase 1 (SULF1) ELISA Kit
MBS4502692-02 96 Tests

Human Sulfatase 1 (SULF1) ELISA Kit

Sign In for Pricing
View Details