Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFlt-3L, His, Mouse

Flt3L, also known as Fms-related tyrosine kinase 3 ligand and SL cytokine, is a single-pass type I membrane protein. It is expressed by stromal cells and T cells. Flt3L signals through tyrosine kinase receptor Flt3/Flk2 to stimulate the proliferation of early hematopoietic progenitor cells. It synergizes with other growth factors, such as GM-CSF, IL-3 and CSF, to promote the differentiation of both myeloid and lymphoid cells. Alternative splicing and proteolytic cleavage of membrane-bound Flt3L generates a soluble extracellular domain (ECD) isoform with full biological activity.

Product Specifications

Product Name Alternative

Fms-related tyrosine kinase 3 ligand, SL cytokine

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 10 ng /ml, measured in a cell proliferation assay using AML5 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

24-30 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Flt3L, His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Flt3L, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEI HFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPR PRHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM87A 3'UTR Luciferase Stable Cell Line
TU025791 1.0 mL

TMEM87A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Phytanoyl-CoA dioxygenase domain-containing protein 1 (PHYHD1) Rat ELISA Kit
F8785 96 Tests

Phytanoyl-CoA dioxygenase domain-containing protein 1 (PHYHD1) Rat ELISA Kit

Sign In for Pricing
View Details
Human SPTBN1 Knockout HEK293T cell line
GTR15415210 1 Vial

Human SPTBN1 Knockout HEK293T cell line

Sign In for Pricing
View Details
AKT1, phosphorylated (Thr308) (AKT1, PKB, RAC, RAC-alpha serine/threonine-protein kinase, Protein kinase B, Protein kinase B alpha, Proto-oncogene c-Akt, RAC-PK-alpha) (MaxLight 550) discontinued
031756-ML550 100 µL

AKT1, phosphorylated (Thr308) (AKT1, PKB, RAC, RAC-alpha serine/threonine-protein kinase, Protein kinase B, Protein kinase B alpha, Proto-oncogene c-Akt, RAC-PK-alpha) (MaxLight 550) discontinued

Sign In for Pricing
View Details
YqjE Antibody
orb836652 2 mg

YqjE Antibody

Sign In for Pricing
View Details
EpCAM Peptide
DF3099-BP 1 mg

EpCAM Peptide

Sign In for Pricing
View Details