Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFlt-3L, Human

Fms-related tyrosine kinase 3 ligand (Flt3L) is growth fator stimulates the proliferation and differentiation of hematopoietic multipotent progenitors and promotes proliferation of NK cells and dendritic cell subgroups by combination with other growth factors. Flt3L is produced by T cells and stromal fibroblasts, and targeted various cells including hematopoietic stem cells, B cells, T cells, dendritic cells, and NK cells [1][2]. Flt3L binds to it cognate tyrosine kinase receptor Flt3 and activates JAK/STAT signaling pathway[3].Flt3L is a hematopoietic four helical bundle cytokine with structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1) demonstrated four conserved cysteines and two glycosylation sites. Flt3L naturally as a non-disulfide-linked homodimer with multiple isoforms. The extracellular portion is approximately 160 amino acid residues in length and the cytoplasmic segment is approximately 20-30 amino acid residues in length[4].

Product Specifications

Product Name Alternative

Flt3 ligand, FL, Flt3LG, SL cytokine, Fms-related tyrosine kinase 3 ligand

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1 x 10ˆ6 units/mg

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

Multiple bands between 18~22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Fms-related tyrosine kinase 3 ligand (Flt-3 Ligand) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFlt-3L should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2,2-Trifluoroethyl N- (3-phenyl-1,2,4-thiadiazol-5-yl) carbamate
EEC95162-01 50 mg

2,2,2-Trifluoroethyl N- (3-phenyl-1,2,4-thiadiazol-5-yl) carbamate

Sign In for Pricing
View Details
2,2,2-Trifluoroethyl N- (3-phenyl-1,2,4-thiadiazol-5-yl) carbamate
EEC95162-02 0.5 g

2,2,2-Trifluoroethyl N- (3-phenyl-1,2,4-thiadiazol-5-yl) carbamate

Sign In for Pricing
View Details
RHEB Rabbit Polyclonal Antibody (BF405)
orb2426896 100 µL

RHEB Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
POTEG Antibody - C-terminal region
OASG06015-100UL 100 µL

POTEG Antibody - C-terminal region

Sign In for Pricing
View Details
SWI/SNF-Related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (SMARCA5) Mouse ELISA Kit
H3840 96 Tests

SWI/SNF-Related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (SMARCA5) Mouse ELISA Kit

Sign In for Pricing
View Details
Human ABCD2 Pre-designed siRNA Set B
SI000064B 1 Each

Human ABCD2 Pre-designed siRNA Set B

Sign In for Pricing
View Details