Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGCP-2/CXCL6, Human

Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human CXC chemokines, GCP­2 is most closely related to ENA­78 (78% amino acid (aa) sequence identity in the mature peptide region and 86% identity in the signal sequence) . The structure and sequence of the genes for human GCP­2 and ENA­78 also exhibit close similarity suggesting the two genes may have originated from a gene duplication. GCP­2 can signal through the CXCR1 and CXCR2 receptors.Recombinant human GCP-2/CXCL6 produced in CHO cells is a polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhGCP-2/CXCL6 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

CXCL6, GCP-2

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human GCP-2/CXCL6 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 0.8 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

9 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human GCP-2°CXCL6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human GCP-2°CXCL6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti Human EphB6 / EphB6 Monoclonal Antibody
MBS2543277-01 0.06 mL

Mouse anti Human EphB6 / EphB6 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti Human EphB6 / EphB6 Monoclonal Antibody
MBS2543277-02 0.12 mL

Mouse anti Human EphB6 / EphB6 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti Human EphB6 / EphB6 Monoclonal Antibody
MBS2543277-03 0.2 mL

Mouse anti Human EphB6 / EphB6 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Programmed cell death protein 4 (PDCD4) ELISA Kit
AE28282MO-01 48 Tests

Mouse Programmed cell death protein 4 (PDCD4) ELISA Kit

Sign In for Pricing
View Details
Mouse Programmed cell death protein 4 (PDCD4) ELISA Kit
AE28282MO-02 96 Tests

Mouse Programmed cell death protein 4 (PDCD4) ELISA Kit

Sign In for Pricing
View Details
TMEM48 Protein Vector (Mouse) (pPB-C-His)
PV239726 500 ng

TMEM48 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details