Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGCP-2/CXCL6, Human

Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human CXC chemokines, GCP­2 is most closely related to ENA­78 (78% amino acid (aa) sequence identity in the mature peptide region and 86% identity in the signal sequence) . The structure and sequence of the genes for human GCP­2 and ENA­78 also exhibit close similarity suggesting the two genes may have originated from a gene duplication. GCP­2 can signal through the CXCR1 and CXCR2 receptors.Recombinant human GCP-2/CXCL6 produced in CHO cells is a polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhGCP-2/CXCL6 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

CXCL6, GCP-2

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human GCP-2/CXCL6 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 0.8 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

9 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human GCP-2°CXCL6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human GCP-2°CXCL6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vps41 3'UTR Luciferase Stable Cell Line
TU223261 1.0 mL

Vps41 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZNF385C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2702905 3x 1.0 µg

ZNF385C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Glucokinase (GCK) (NM_033508) Human Tagged ORF Clone Lentiviral Particle
RC218920L1V 200 µL

Glucokinase (GCK) (NM_033508) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GNAO1 Polyclonal Antibody, Cy5.5 Conjugated
bs-6962R-Cy5.5 100 µL

GNAO1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Human Basement membrane-specific heparan sulfate proteoglycan core protein ELISA kit
GTR10376454 96 Well

Human Basement membrane-specific heparan sulfate proteoglycan core protein ELISA kit

Sign In for Pricing
View Details
JPH1 (Junctophilin-1, JP-1, Junctophilin Type 1, JP1, DKFZp762L0313) (MaxLight 650)
128686-ML650 100 µL

JPH1 (Junctophilin-1, JP-1, Junctophilin Type 1, JP1, DKFZp762L0313) (MaxLight 650)

Sign In for Pricing
View Details