Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGCP-2/CXCL6, Human

Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human CXC chemokines, GCP­2 is most closely related to ENA­78 (78% amino acid (aa) sequence identity in the mature peptide region and 86% identity in the signal sequence) . The structure and sequence of the genes for human GCP­2 and ENA­78 also exhibit close similarity suggesting the two genes may have originated from a gene duplication. GCP­2 can signal through the CXCR1 and CXCR2 receptors.Recombinant human GCP-2/CXCL6 produced in CHO cells is a polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhGCP-2/CXCL6 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

CXCL6, GCP-2

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human GCP-2/CXCL6 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 0.8 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

9 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human GCP-2°CXCL6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human GCP-2°CXCL6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae UPF0479 membrane protein YPR204C-A (YPR204C-A), partial
MBS7059313 Inquire

Recombinant Saccharomyces cerevisiae UPF0479 membrane protein YPR204C-A (YPR204C-A), partial

Sign In for Pricing
View Details
K48-linkage specific ubiquitin Recombinant Rabbit mAb, PE-Cy5.5 conjugated
orb3163770 100 µL

K48-linkage specific ubiquitin Recombinant Rabbit mAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Porcine Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform ELISA kit
GTR10379122 96 Well

Porcine Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform ELISA kit

Sign In for Pricing
View Details
Mig12 HDR Plasmid (h)
sc-412921-HDR 20 µg

Mig12 HDR Plasmid (h)

Sign In for Pricing
View Details
Lp (a) -IN-7
HY-173323 1 Each

Lp (a) -IN-7

Sign In for Pricing
View Details
MCCD1 (NM_001011700) Human Over-expression Lysate
E45H03739-2 20 µg

MCCD1 (NM_001011700) Human Over-expression Lysate

Sign In for Pricing
View Details