Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantG-CSF, Human (CHO-expressed)

Human Granulocyte Colony Stimulating Factor (G-CSF) contains internal disulfide bonds. Among the family of colony-stimulating factors, Granulocyte Colony Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of Granulocyte Colony Stimulating Factor (G-CSF) can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits the synthesis of Granulocyte Colony Stimulating Factor (G-CSF) . In epithelial, endothelial, and fibroblastic cells, the secretion of Granulocyte Colony Stimulating Factor (G-CSF) is induced by Interleukin-17.

Product Specifications

Product Name Alternative

Granulocyte Colony-Stimulating Factor, CSF-3, CSF3, MGI-1G, GM-CSFb, pluripoietin

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED501 x 10ˆ7 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

18.7kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Granulocyte Colony Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhG-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHS GLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSF LEVSYRVLRHLAQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CAPN15 knockout cell line
ABC-KH2336 1 Vial

Human CAPN15 knockout cell line

Sign In for Pricing
View Details
Bovine Teneurin 1 (ODZ1) ELISA Kit
GTR10312451 96 Well

Bovine Teneurin 1 (ODZ1) ELISA Kit

Sign In for Pricing
View Details
RYR2 Antibody, FITC conjugated
A45961-50UG 50 µg

RYR2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Vmn2r116 (NM_001104580) Mouse Tagged ORF Clone
MR225352 10 µg

Vmn2r116 (NM_001104580) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GPR97 Antibody
MBS9604289-01 0.1 mL

GPR97 Antibody

Sign In for Pricing
View Details
GPR97 Antibody
MBS9604289-02 0.2 mL

GPR97 Antibody

Sign In for Pricing
View Details