Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantG-CSF, Human (CHO-expressed)

Human Granulocyte Colony Stimulating Factor (G-CSF) contains internal disulfide bonds. Among the family of colony-stimulating factors, Granulocyte Colony Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of Granulocyte Colony Stimulating Factor (G-CSF) can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits the synthesis of Granulocyte Colony Stimulating Factor (G-CSF) . In epithelial, endothelial, and fibroblastic cells, the secretion of Granulocyte Colony Stimulating Factor (G-CSF) is induced by Interleukin-17.

Product Specifications

Product Name Alternative

Granulocyte Colony-Stimulating Factor, CSF-3, CSF3, MGI-1G, GM-CSFb, pluripoietin

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED501 x 10ˆ7 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

18.7kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Granulocyte Colony Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhG-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHS GLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSF LEVSYRVLRHLAQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Svil Mouse shRNA Plasmid (Locus ID 225115)
TR506690 1 Kit

Svil Mouse shRNA Plasmid (Locus ID 225115)

Sign In for Pricing
View Details
BTG4 Conjugated Antibody
orb1616847 100 µL

BTG4 Conjugated Antibody

Sign In for Pricing
View Details
Vom1r54 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6284203 1.0 µg DNA

Vom1r54 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
HIV-1 TAT 48-60
orb1679550-01 1 mg

HIV-1 TAT 48-60

Sign In for Pricing
View Details
HIV-1 TAT 48-60
orb1679550-02 5 mg

HIV-1 TAT 48-60

Sign In for Pricing
View Details
HIV-1 TAT 48-60
orb1679550-03 10 mg

HIV-1 TAT 48-60

Sign In for Pricing
View Details