Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGH, Human (CHO-expressed)

Growth hormone (GH), also known as somatotropin, is a member of a family of growth factors that includes prolactin, placental lactogens, proliferins, and somatolactin. It is synthesized primarily by somatotropes in the anterior pituitary and is stored in secretary granules. The pulsatile release of GH into circulation is regulated by the concerted actions of the hypothalamic hormones-GH-releasing hormone (GHRH) and somatostatin (SST) - as well as by signals from the periphery - ghrelin and leptin. The human GH cDNA encodes a 217 amino acid (aa) residue precursor protein with a 26 aa putative signal peptide. By alternative splicing, at least four isoforms of GH have been identified.

Product Specifications

Product Name Alternative

GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2 x 10ˆ6 units/mg

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

20-24 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Growth Hormone (GH) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhGH should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

FPTIPLSRLFDNASLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISL LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY GLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP Rabbit pAb, Pacific Blue conjugated
orb2864882 100 µL

TRIP Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
CTXI (Cross Linked C-telopeptide of Type I Collagen) BioAssayTM ELISA Kit (Rabbit) discontinued
355071-01 48 Tests

CTXI (Cross Linked C-telopeptide of Type I Collagen) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
CTXI (Cross Linked C-telopeptide of Type I Collagen) BioAssayTM ELISA Kit (Rabbit) discontinued
355071-02 96 Tests

CTXI (Cross Linked C-telopeptide of Type I Collagen) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
NPTXR, ID (NPTXR, Neuronal pentraxin receptor) (Biotin)
039104-Biotin 200 µL

NPTXR, ID (NPTXR, Neuronal pentraxin receptor) (Biotin)

Sign In for Pricing
View Details
MRP7 (Multidrug Resistance-associated Protein 7, ATP-binding Cassette Sub-family C Member 10, ABCC10, SIMRP7)
M4688-33B 100 µg

MRP7 (Multidrug Resistance-associated Protein 7, ATP-binding Cassette Sub-family C Member 10, ABCC10, SIMRP7)

Sign In for Pricing
View Details
ASCL3 (Achaete-scute Complex Homolog 3 (Drosophila), HASH3, SGN1, bHLHa42) (APC)
MBS6170211-01 0.1 mL

ASCL3 (Achaete-scute Complex Homolog 3 (Drosophila), HASH3, SGN1, bHLHa42) (APC)

Sign In for Pricing
View Details